LC-MS/MS is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2025-03-22. Where a claim depends on a specific study, the study is described rather than over-claimed.
Analytical methods for SR9009 typically rely on liquid chromatography coupled with tandem mass spectrometry. The technique can separate the parent compound from related substances and detect low concentrations in biological matrices. Urine and blood are common samples in anti-doping testing, while in vitro studies may use cell culture media. Rapid metabolism and low expected concentrations make method validation important for reliable identification. Exact metabolite patterns can vary by species and are not fully mapped.
Regulatory treatment of SR9009 reflects its investigational status. The compound has no approved human therapeutic indication, and sports authorities prohibit its use. It appears on anti-doping lists as a non-approved substance or metabolic modulator, depending on the list version. Products sold online as research chemicals are not quality-controlled medicines, so their identity and purity can differ from the label. Such products may also contain unlisted compounds, which complicates both testing and safety assessment.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ, also called NR1D1 and NR1D2. These receptors help regulate circadian rhythms and metabolic gene programs. The compound was developed for laboratory research, not as an approved therapeutic. Its identity is distinct from steroid hormones and selective androgen receptor modulators. Scientific interest centers on how REV-ERB activation changes gene expression in cells and animal models.
At the molecular level, SR9009 binds the ligand-binding domain of REV-ERB and strengthens recruitment of corepressor proteins such as NCoR and HDAC3. This increases repression of target genes, including Bmal1 and other clock-controlled and metabolic genes. In rodent studies, such changes have been linked to altered lipid handling, glucose metabolism, and energy expenditure. The precise chain of events between receptor binding and whole-body effects remains an active area of research. Findings in animals do not automatically translate to humans.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved for human use | Investigational status in most countries |
| Sports status | Prohibited by WADA | Classified as non-approved or metabolic modulator |
| Common analytical method | LC-MS/MS | Used for trace detection in biological samples |
| Typical test matrices | Urine and blood | Sample choice depends on testing program |
| Human trial data | None published | Effects and safety are not established |
SR9009 is not approved as a medicine by major regulatory agencies. It is commonly sold as a research chemical, a category that may fall outside customary drug approval and quality rules. In sports, the World Anti-Doping Agency lists SR9009 as a prohibited substance. Athletes who use it can face sanctions if it is detected in a sample. Legal status varies by country, and importation may be restricted. Enforcement practices differ across borders.
Detection of SR9009 in biological samples usually employs liquid chromatography coupled with tandem mass spectrometry. This method can identify the parent compound and sometimes metabolites in urine or blood. Because exposure can be low and clearance may be rapid, sample timing and limits of detection matter. Laboratories validate assays for sensitivity and specificity. Results are interpreted alongside chain-of-custody and quality-control records. Urine is the common matrix for anti-doping analysis, while blood may be used in research settings.
At the molecular level, SR9009 binds REV-ERBα and REV-ERBβ and alters their repressive activity on target genes. These nuclear receptors help regulate the circadian clock, lipid synthesis, glucose metabolism, and inflammatory pathways. By changing transcription, the compound can shift the timing or magnitude of downstream metabolic processes in model systems. It does not act through androgen receptors or adenosine receptors, which distinguishes it from several substances sold for athletic performance. Whether the same transcriptional changes occur in humans at tolerable exposures remains an open question because controlled human studies are lacking.
Preclinical reports describe effects on exercise endurance, mitochondrial content, and lipid profiles in rodents, but these findings come from specific experimental conditions. Many studies use high doses or delivery methods that may not translate directly to human use. SR9009 has been reported to have low oral bioavailability and a short half-life, which complicates interpretation of oral dosing studies. It is not established as safe or effective for any indication. Literature discussions often separate its pharmacological mechanism from unverified claims made in fitness and supplement markets.
Aspartate has many other biochemical roles. It is a metabolite in the urea cycle and participates in gluconeogenesis. It carries reducing equivalents in the malate-aspartate shuttle, which utilizes the ready interconversion of aspartate and oxaloacetate, which is the oxidized (dehydrogenated) derivative of malic acid. Aspartate donates one nitrogen atom in the biosynthesis of inosine, the precursor to the purine bases. In addition, aspartic acid acts as a hydrogen acceptor in a chain of ATP synthase. Dietary L-aspartic acid has been shown to act as an inhibitor of Beta-glucuronidase, which serves to regulate enterohepatic circulation of bilirubin and bile acids. Click on genes, proteins and metabolites below to link to respective articles. Aspartate (the conjugate base of aspartic acid) stimulates NMDA receptors, though not as strongly as the amino acid neurotransmitter L-glutamate does. Aspartate is the "A" in NMDA (N-methyl-D-aspartate receptor).
2-Hydroxybutyrate, the conjugate base of 2-hydroxybutyric acid, is produced in mammalian tissues (principally hepatic) that catabolize L-threonine or synthesize glutathione. Oxidative stress or detoxification demands can dramatically increase the rate of hepatic glutathione synthesis. Under such metabolic stress conditions, supplies of L-cysteine for glutathione synthesis become limiting, so homocysteine is diverted from the transmethylation pathway forming methionine into the transsulfuration pathway forming cystathionine. 2-Hydroxybutyrate is released as a byproduct when cystathionine is cleaved to cysteine that is incorporated into glutathione. Chronic shifts in the rate of glutathione synthesis may be reflected by urinary excretion of 2-hydroxybutyrate. α-hydroxybutyrate may be useful as an early indicator of insulin resistance in non-diabetic subjects. Moreover, elevated serum α-hydroxybutyrate predicts worsening glucose tolerance.
June 29 – July 6: 2019 Men's U20 European Lacrosse Championship in Prague (debut event) England defeated Germany, 9–8, to win the inaugural Men's U20 European Lacrosse Championship title. The Czech Republic took third place. July 16 – 25: 2019 Women's European Lacrosse Championship in Netanya England defeated Israel, 10–7, to win their third consecutive and seventh overall Women's European Lacrosse Championship title. Wales took third place. August 1 – 10: 2019 FIL Women's Under-19 World Lacrosse Championships in Peterborough The United States defeated Canada, 13–3, to win their fifth Women's Under-19 World Lacrosse Championships title. Australia took third place. September 19 – 28: 2019 World Indoor Lacrosse Championship in Langley Canada defeated Haudenosaunee, 19–12, to win their fifth consecutive World Indoor Lacrosse Championship title. United States took third place.
Sources: en.wikipedia.org
In 2000, the NHTSA released a regulation making trunk releases mandatory for new cars by September of the following year due, in part, to the lobbying efforts of Janette Fennell. In 2003, the IIHS began conducting side impact crash tests. In 2004, NHTSA released new tests designed to test the rollover risk of new cars and SUVs. Only the Mazda RX-8 got a 5-star rating. Also in 2003, the National Highway Traffic Safety Administration (NHTSA) introduced a female counterpart crash test dummy of Hybrid III. This dummy was just a scaled-down version of the original Hybrid III, only representing the smallest 5% of women based on mid-1970s standards. In 2009, Citroën became the first manufacturer to feature "Snowmotion", an Intelligent Anti Skid system developed in conjunction with Bosch, which gives drivers a level of control in extreme ice or snow conditions similar to a 4x4. In 2009, NHTSA upgraded its roof-crush standard for vehicles weighing 6000 pounds or less. The new standard increased the crush load requirement from 1.5 to 3 times the vehicle's curb weight.
5-HTP has been used medically and as a supplement under the name oxitriptan in the treatment of depression and for certain other indications. As of 2025, there are no current FDA approved medications containing 5-HTP. It can be potentiated in combination with a peripherally selective aromatic L-amino acid decarboxylase (AAAD) inhibitor such as carbidopa or benserazide. These agents increase the strength and duration of oxitriptan. An investigational combination formulation is oxitriptan/carbidopa.
The permeability of a membrane is the rate of passive diffusion of molecules through the membrane. These molecules are known as permeant molecules. Permeability depends mainly on the electric charge and polarity of the molecule and to a lesser extent the molar mass of the molecule. Due to the cell membrane's hydrophobic nature, small electrically neutral molecules pass through the membrane more easily than charged, large ones. The inability of charged molecules to pass through the cell membrane results in pH partition of substances throughout the fluid compartments of the body. Lipids, Membranes and Vesicle Trafficking – The Virtual Library of Biochemistry and Cell Biology Cell membrane protein extraction protocol Membrane homeostasis, tension regulation, mechanosensitive membrane exchange and membrane traffic 3D structures of proteins associated with plasma membrane of eukaryotic cells Lipid composition and proteins of some eukariotic membranes Prokaryotic and Eukaryotic Cells
Sources: en.wikipedia.org
AM function can be compared to another peptide called pro-adrenomedullin N-terminal 20 peptide (PAMP), which both originate from a common precursor leading to angiogenesis, vasodilation, and anti-inflammatory processes. These two peptides are expressed in the gastrointestinal (GI) tract at a mass level, serving as GI hormones controlling processes like insulin secretion and gastric emptying. Past studies reveal that AM and PAMP also impact gut microbiome composition by fostering the development of beneficial bacteria (i.e., Bifidobacterium and Lactobacillus) and diminishing detrimental microbes.
Calmodulin-like protein 5 is a protein that in humans is encoded by the CALML5 gene. This gene encodes a novel calcium binding protein expressed in the epidermis and related to the calmodulin family of calcium binding proteins. Functional studies with recombinant protein demonstrate it does bind calcium and undergoes a conformational change when it does so. Abundant expression is detected only in reconstructed epidermis and is restricted to differentiating keratinocytes. In addition, it can associate with transglutaminase 3, shown to be a key enzyme in the terminal differentiation of keratinocytes. Human CALML5 genome location and CALML5 gene details page in the UCSC Genome Browser. Overview of all the structural information available in the PDB for UniProt: Q9NZT1 (Human Calmodulin-like protein 5) at the PDBe-KB.
AlphaKnot is a scientific database and web server for detecting, classifying, and visualizing protein knots and other forms of protein-chain entanglement. It was developed to facilitate the analysis of protein structures predicted by AlphaFold and other machine-learning methods, but can also be used to analyze experimentally determined structures. The current version, AlphaKnot 2.0, combines two closely related components: a precomputed database containing proteins identified as knotted in large-scale structure-prediction datasets, and an analysis server that allows users to investigate the topology of individual protein structures in greater detail.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
No. It is an investigational compound without approved therapeutic indications. It is sold for research purposes only in many jurisdictions.
Sports authorities prohibit it because it is not approved for human use and has potential performance-enhancing effects. It appears on anti-doping lists under non-approved or metabolic modulator categories.
Detection usually uses liquid chromatography-tandem mass spectrometry. The method targets the parent compound or its metabolites in urine or blood.
SR9009 is a synthetic research compound that activates the REV-ERBα and REV-ERBβ nuclear receptors. It is not an approved drug and has no established human therapeutic use. Most published biological data come from cell and rodent studies.