If you have been reading about GHK-Cu and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-03-23. Numbers and descriptions here follow the published literature rather than marketing material.
Copper(II) binds the peptide through four nitrogen donors: the terminal amino group, the imidazole nitrogen of histidine, and two deprotonated amide nitrogens of the peptide backbone. This tetradentate arrangement gives a roughly square-planar geometry, the thermodynamically favoured form near neutral pH. Because the amide nitrogens must lose a proton before they can coordinate, complex formation is strongly pH-dependent, and the fully coordinated species dominates only above mildly acidic conditions. Electronic transitions within the copper d orbital set produce the characteristic blue to violet colour in aqueous solution.
Endogenous GHK occurs in blood plasma, saliva, and urine, and reported plasma concentrations decline with age in several studies. Researchers have proposed that the peptide acts as a copper carrier that delivers the metal to cells and to sites of injury. That transport role is a hypothesis supported by binding measurements and tissue-distribution data rather than a settled mechanism, and the peptide is generally described as a minor contributor to total plasma copper transport. Values reported in wound fluid and certain tissue extracts are higher than in circulating plasma.
The sequence carries three residues in the order glycine, histidine, lysine, which places a small, flexible chain around a single metal centre. Compared with larger copper-binding proteins, the complex is compact and its coordination chemistry can be reproduced with synthetic peptide in a laboratory. Published structural work agrees on the nitrogen donor set but differs in the exact geometry assigned under some conditions, so the arrangement is best treated as well characterised in outline rather than fixed in every detail.
Mechanistic accounts focus on how the complex delivers copper and how the released peptide interacts with the extracellular matrix. Copper is an essential cofactor for lysyl oxidase and other enzymes involved in collagen and elastin cross-linking, and GHK is one of several peptides able to carry the metal. Reported effects include altered gene expression in fibroblasts and changes in matrix metalloproteinase activity, although many of these findings come from cell culture rather than whole organisms. The relative contribution of the peptide backbone, the copper ion, and downstream copper metabolism is not fully resolved.
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-lysine and a copper(II) ion. The peptide sequence is conventionally written as Gly-His-Lys, abbreviated GHK. Copper binds through the imidazole nitrogen of histidine, the alpha-amino group, and a deprotonated amide nitrogen, producing a square-planar geometry. The complex carries a net positive charge near physiological pH and is intensely blue in aqueous solution. The metal-free peptide is often written simply as GHK, while the copper-bound form is written GHK-Cu.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Copper(II)-tripeptide complex | One peptide ligand with one coordinated metal centre |
| Peptide sequence | Gly-His-Lys | Three residues written in one-letter notation |
| Free peptide mass | 340.4 g/mol | Metal-free GHK; the complex has a higher mass |
| Appearance | Blue to violet solid or solution | Colour originates from copper d orbital transitions |
| Storage | Desiccated, -20 °C, protected from light | Dry powder is more stable than dissolved material |
The peptide sequence places a histidine in the middle, and this residue dominates metal binding. Copper(II) coordinates through the imidazole nitrogen of histidine and the terminal amino group, forming a stable chelate ring system. Loss of the copper ion leaves the free tripeptide, which has different solubility and reactivity. This structural detail matters because assays that measure only the peptide backbone can miss whether copper is still bound to it.
Several names circulate for the same material, which complicates literature searches. Cosmetic ingredient lists often use copper tripeptide-1, while older biochemistry papers use glycyl-L-histidyl-lysine or its abbreviation GHK. The copper complex is sometimes written as GHK-Cu(II) to make the oxidation state explicit. Terminology is not fully standardized, so matching a compound across sources requires attention to the exact sequence, the counterion, and the stated copper content. Reviews that compare studies must account for these naming differences before drawing conclusions.
GHK-Cu is the copper(II) complex of the tripeptide glycyl-L-histidyl-L-lysine, a short sequence of three amino acids. The peptide was first isolated from human plasma in 1973 during research on factors that influence tissue repair in liver. Its ability to bind copper ions became a central point of interest because the metal changes the peptide's chemistry and its behaviour in laboratory systems. Today the compound appears in cosmetic formulations, cell-culture studies, and biochemistry literature under several names.
GHK-Cu is the copper-binding complex formed by the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The free peptide is usually written as GHK, and the complex is written as GHK-Cu or Cu-GHK. The sequence was identified in human plasma and later detected in saliva and urine. Its name comes from the single-letter codes of glycine, histidine and lysine. The complex is widely described as a naturally occurring carrier of copper in blood rather than as a free peptide with its own hormonal role.
Copper binds to the peptide through the histidine imidazole nitrogen and the terminal amino group, forming a stable square-planar complex. Binding constants reported for copper(II) with GHK are high, so the peptide competes effectively for copper in solution. The complex absorbs visible light, which gives solutions a blue to violet colour. Whether the metal-free peptide has a distinct biological function of its own is still an open question; some work treats it mainly as a copper delivery vehicle, while other work reports peptide-specific effects.
The Ingram family's steadfast refusal to franchise, take on debt or offer shares to the public throughout the company's existence has kept the chain relatively small, with a more discontinuous geography than its principal competitors. There are currently 345 White Castle outlets, as of May 17, 2024, predominantly in the Midwest, Kentucky, and Tennessee. The exceptions are over 50 White Castle locations in the New York—New Jersey metropolitan area (as of 2025), four locations around Las Vegas, Nevada, four in the Phoenix metropolitan area in Arizona, one in Orlando, Florida, and two in Shanghai, China. By comparison, there are over 36,000 McDonald's locations globally, with approximately 14,000 of those in the United States. The chain does, however, sell frozen sliders at supermarkets nationwide, with availability varying by chain. White Castle currently has locations in the following metropolitan areas in the United States:
=== Antibody-drug conjugates === Antibody-drug conjugates (ADCs) are antibodies linked to one or more drug molecules. Typically when the ADC meets the target cell (e.g. a cancerous cell) the drug is released to kill it. Many ADCs are in clinical development. As of 2016 a few have been approved.
=== Occurrence in fungi === Many fungi produce hydrogen cyanide from glycine. These include representatives of the genera funnel mushrooms (Clitocybe), dwindlers (Marasmius), stem porcini (Polyporus), and Ritterlinge (Tricholoma). The epurpurins are a group of yellow phenolic pigments, each bearing two nitrile groups, occurring in Emericella purpurea. Diatretin II occurs in Fleshy Fungus (Clitocybe diatreta) and in the purple reddish bolete. In the clove dwarf mushroom, the cyanohydrin of glyoxylic acid is present; it is formed from two glycine molecules and releases hydrocyanic acid upon tissue damage.
== Application in biotechnology == In some of the aminoacyl tRNA synthetases, the cavity that holds the amino acid can be mutated and modified to carry unnatural amino acids synthesized in the lab, and to attach them to specific tRNAs. This expands the genetic code, beyond the twenty canonical amino acids found in nature, to include an unnatural amino acid as well. The unnatural amino acid is coded by a nonsense (TAG, TGA, TAA) triplet, a quadruplet codon, or in some cases a redundant rare codon. The organism that expresses the mutant synthetase can then be genetically programmed to incorporate the unnatural amino acid into any desired position in any protein of interest, allowing biochemists or structural biologists to probe or change the protein's function. For instance, one can start with the gene for a protein that binds a certain sequence of DNA, and, by directing an unnatural amino acid with a reactive side-chain into the binding site, create a new protein that cuts the DNA at the target-sequence, rather than binding it. By mutating aminoacyl tRNA synthetases, chemists have expanded the genetic codes of various organisms to include lab-synthesized amino acids with all kinds of useful properties: photoreactive, metal-chelating, xenon-chelating, crosslinking, spin-resonant, fluorescent, biotinylated, and redox-active amino acids. Another use is introducing amino acids bearing reactive functional groups for chemically modifying the target protein.
== History == In the early 1900s, immunologist Paul Ehrlich proposed the idea of a Zauberkugel – "magic bullet", conceived of as a compound which selectively targeted a disease-causing organism, and could deliver a toxin for that organism. This underpinned the concept of monoclonal antibodies and monoclonal drug conjugates. Ehrlich and Élie Metchnikoff received the 1908 Nobel Prize for Physiology or Medicine for providing the theoretical basis for immunology. By the 1970s, lymphocytes producing a single antibody were known, in the form of multiple myeloma – a cancer affecting B-cells. These abnormal antibodies or paraproteins were used to study the structure of antibodies, but it was not yet possible to produce identical antibodies specific to a given antigen. In 1973, Jerrold Schwaber described the production of monoclonal antibodies using human–mouse hybrid cells. This work remains widely cited among those using human-derived hybridomas. In 1975, Georges Köhler and César Milstein succeeded in making fusions of myeloma cell lines with B cells to create hybridomas that could produce antibodies, specific to known antigens and that were immortalized. They and Niels Kaj Jerne shared the Nobel Prize in Physiology or Medicine in 1984 for the discovery. In 1988, Gregory Winter and his team pioneered the techniques to humanize monoclonal antibodies, eliminating the reactions that many monoclonal antibodies caused in some patients. By the 1990s research was making progress in using monoclonal antibodies therapeutically, and in 2018, James P.
Sources: en.wikipedia.org
TSH (with a half-life of about an hour) stimulates the thyroid gland to secrete the hormone thyroxine (T4), which has only a slight effect on metabolism. T4 is converted to triiodothyronine (T3), which is the active hormone that stimulates metabolism. About 80% of this conversion is in the liver and other organs, and 20% in the thyroid itself. TSH is secreted throughout life but particularly reaches high levels during the periods of rapid growth and development, as well as in response to stress. The hypothalamus, in the base of the brain, produces thyrotropin-releasing hormone (TRH). TRH stimulates the anterior pituitary gland to produce TSH. Somatostatin is also produced by the hypothalamus, and has an opposite effect on the pituitary production of TSH, decreasing or inhibiting its release. The concentration of thyroid hormones (T3 and T4) in the blood regulates the pituitary release of TSH; when T3 and T4 concentrations are low, the production of TSH is increased, and, conversely, when T3 and T4 concentrations are high, TSH production is decreased. This is an example of a negative feedback loop. Any inappropriateness of measured values, for instance a low-normal TSH together with a low-normal T4 may signal tertiary (central) disease and a TSH to TRH pathology. Elevated reverse T3 (RT3) together with low-normal TSH and low-normal T3, T4 values, which is regarded as indicative for euthyroid sick syndrome, may also have to be investigated for chronic subacute thyroiditis (SAT) with output of subpotent hormones.
In John Gould's Handbook to the Birds of Australia, first published in 1865, he lamented the loss of the emu from Tasmania, where it had become rare and has since become extinct; he noted that emus were no longer common in the vicinity of Sydney and proposed that the species be given protected status. In the 1930s, emu killings in Western Australia peaked at 57,000, and culls were also mounted in Queensland during this period due to rampant crop damage. In the 1960s, bounties were still being paid in Western Australia for killing emus, but since then, wild emus have been granted formal protection under the Environment Protection and Biodiversity Conservation Act 1999. Their occurrence range is between 4,240,000 and 6,730,000 km2 (1,640,000–2,600,000 sq mi), and a 1992 census suggested that their total population was between 630,000 and 725,000. Their population trend is thought to be stable and the International Union for Conservation of Nature assesses their conservation status as being of least concern. The isolated emu population of the New South Wales North Coast Bioregion and Port Stephens is listed as endangered by the New South Wales Government. Although the population of emus on mainland Australia is thought to be higher now than it was before European settlement, some local populations are at risk of extinction. The threats faced by emus include the clearing and fragmentation of areas of suitable habitat, deliberate slaughter, collisions with vehicles and predation of the eggs and young.
=== Combined & global === A different modality is when lysosomes do not just act alone, but in concert with the ER. In this scenario, lysosomes first supply a local, 'trigger' Ca2+ release that then secondarily recruits the IP3Rs or RyRs on the ER by Calcium-induced calcium release (the 'amplifier'). In this mode, lysosomes indirectly evoke a global cytosolic Ca2+ signal (which is actually mediated by the ER). In this way, lysosomal Ca2+ release is amplified, in what is referred to as the 'trigger hypothesis'.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
Sources: en.wikipedia.org
The 15N HSQC experiment is one of the most frequently recorded experiments in protein NMR. The HSQC experiment can be performed using the natural abundance of the 15N isotope, but normally for protein NMR, isotopically labeled proteins are used. Such labelled proteins are usually produced by expressing the protein in cells grown in 15N-labelled media. Each residue of the protein, with the exception of proline, has an amide proton attached to a nitrogen in the peptide bond. The HSQC provides the correlation between the nitrogen and amide proton, and each amide yields a peak in the HSQC spectra. Each residue (except proline) therefore can produce an observable peak in the spectra, although in practice not all the peaks are always seen due to a number of factors. Normally the N-terminal residue (which has an NH3+ group attached) is not readily observable due to exchange with solvent. In addition to the backbone amide resonances, sidechains with nitrogen-bound protons will also produce peaks. In a typical HSQC spectrum, the NH2 peaks from the sidechains of asparagine and glutamine appear as doublets on the top right corner, and a smaller peak may appear on top of each peak due to deuterium exchange from the D2O normally added to an NMR sample, giving these sidechain peaks a distinctive appearance. The sidechain amine peaks from tryptophan are usually shifted downfield and appear near the bottom left corner. The backbone amide peaks of glycine normally appear near the top of the spectrum.
==== Finance and monetary policy ==== In 2008 and 2009, Sanders voted against the Troubled Asset Relief Program (TARP), a program to purchase toxic banking assets and provide loans to banks that were in free-fall. On February 4, 2009, he sponsored an amendment to ensure that TARP funds would not displace US workers. The amendment passed and was added to the American Recovery and Reinvestment Act of 2009. Among his proposed financial reforms is auditing the Federal Reserve, which would reduce its independence in monetary policy deliberations; Federal Reserve officials say that "Audit the Fed" legislation would expose the Federal Reserve to undue political pressure from lawmakers who do not like its decisions.
==== Nanoparticles ==== An efficient way to synthesize protein-polymer hybrid nanoparticles is to take advantage of photoinitiated reversible addition−fragmentation chain transfer (RAFT) polymerization-induced self-assembly(PISA) by using multi-RAFT modified bovine serum albumin (BSA) as a macromolecular chain transfer agent. RAFT mediated growth of the PHPMA chains will graft from the BSA-RAFT, and increase the hydrophobicity of the star BSA−PHPMA conjugates. At the critical aggregation concentration, they form nanoparticles due to the hydrophobic interactions. The resulting nanoparticles show excellent encapsulation capability for both hydrophobic and hydrophilic molecules, such as cancer drugs and DNA. A rather easy method to prepare protein-polymer hybrid nanoparticles is nanoprecipitation. Spherical nanoparticles composed of BSA-PMMA with diameters of around 100 nm were obtained and the water insoluble chemotherapeutic drug camptothecin was encapsulated within the hydrophobic core consisting of PMMA. Such protein-polymer hybrid nanoparticles possess tunable sizes and surface charges, have attractive bio-compatibilities and allow efficient cell uptake. Camptothecin-encapsulated BSA-PMMA nanoparticles revealed enhanced anti-tumor activity both in vitro and in animals. Beyond the nanoscale, protein-polymer conjugate could also be used as building blocks for constructing more complicated structures such as microcapsules through hydrophobic interactions.
Sources: en.wikipedia.org
It consists of a three-amino-acid peptide, glycine-histidine-lysine, bound to one copper(II) ion. The peptide supplies four nitrogen donor atoms, and the resulting complex is stable in neutral aqueous solution. The metal-free peptide is usually called GHK.
The three letters are the standard one-letter codes for glycine, histidine, and lysine. The suffix -Cu indicates the coordinated copper ion. Cosmetic ingredient lists often use the alternative name copper tripeptide-1 for the same complex.
No. Free GHK is the peptide alone, while GHK-Cu contains a bound copper atom. The two differ in colour, charge, and binding behaviour, so any study that measures copper delivery must state which form was used.
It is the copper(II) complex of the tripeptide glycyl-L-histidyl-lysine, a sequence of three amino acids. The copper ion is held by the histidine imidazole, the terminal amino group, and an amide nitrogen. The bound form is distinct from the free peptide in charge, color, and stability.